Shrimp viewing cave

Shrimp viewing cave

Personal use only ♥ 107 likes ↓ 438 downloads Household

Have us print this for you

PLA from £6 inc. UK delivery on letter-sized prints. We slice, print on a calibrated Creality K2 / Bambu A1, QC and post.

A cave in your substrate that allows you to watch your shrimp (or fish) under the traditional space of the tank.

fishcavefishtankshrimpshrimptankshrimps

More popular Household models